PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_16413g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 342aa    MW: 38599.1 Da    PI: 5.2731
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_16413g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.5e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l  +++ +G g+W+  ++  g++R++k+c++rw +yl
    MA_16413g0010 14 RGSWTREEDMILSGYIQTHGDGDWRNLPKNAGLKRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.22.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MA_16413g0010  67 RGSISPDEEDLIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7888******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.641961IPR017930Myb domain
SuperFamilySSF466898.03E-2812108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002491.2E-121461IPR001005SANT/Myb domain
CDDcd001674.55E-91661No hitNo description
PROSITE profilePS5129426.55362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2565116IPR009057Homeodomain-like
SMARTSM007175.6E-1666114IPR001005SANT/Myb domain
PfamPF002494.7E-1567112IPR001005SANT/Myb domain
CDDcd001674.05E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGSWTRE EDMILSGYIQ THGDGDWRNL PKNAGLKRCG KSCRLRWINY  60
LRPDIKRGSI SPDEEDLIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKKLPSMK  120
QSQANSSTKY LKMTSKSSSP LPNHVFKTIA VKITTAVTGS EIVRPHSCNG HACSNRSSNE  180
AFKSCNVEET TNSSKSCCNV LADDSITYDE SQRIALAMTD INFEKAQGRD STCTMSSLED  240
EESRHSDHFP EDAAILTESL LDFNDLAFPR WNLLFSPSDC PTDFGLEELY MGAAVEMNEP  300
EDIMCFDQSN MQSVNNLTFP DNQGMEELHD NTHVYCIDEV VY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1167521e-117BT116752.1 Picea glauca clone GQ03806_A01 mRNA sequence.
GenBankKU1312191e-117KU131219.1 Picea abies transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LMJ61e-132B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.17e-66myb domain protein 12